Bacterial taxon 262316
Locus MAP_1638c
Protein AAS03955.1
hypothetical protein
Mycobacterium avium subsp. paratuberculosis K10
Length 206 aa, Gene n/a, UniProt Q73ZG5
>AAS03955.1|Mycobacterium avium subsp. paratuberculosis K10|hypothetical protein
MEATLVDTSRRIGTIICALALPAGAVGCGGHGHGPTTTPSTPKVTTLGRTAPNAPAGGPLTITSPAFTDGAPIPPRYTCKGEGIAPPLAWSAPTGAALVVDDPDAPGGGGGGPYVHWVVTGIAPGSGSTSAGQTPPGTTTLPNTAGQAGYQGPCPPAGTGTHHYRFTLYQLPNDYQLPAGLAGVQAAQTIGAAATAQAQLTGTFGG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 1 month | 1,792,920 | -4.27 | 0.03 | ●●○○○ -1.72 | -1.7243075253048004 | 24885784 |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 1 month | 1,792,902 | 7.37 | 0.015 | ○○○○○ 2.09 | 2.091315050287801 | 24885784 |
Retrieved 2 of 2 entries in 9.1 ms
(Link to these results)