Bacterial taxon 262316
Locus MAP_1693c
Protein AAS04010.1
hypothetical protein
Mycobacterium avium subsp. paratuberculosis K10
Length 188 aa, Gene n/a, UniProt Q73ZB0
>AAS04010.1|Mycobacterium avium subsp. paratuberculosis K10|hypothetical protein
MTAVNSVRTFSAAAFAACFTAAAAMLAGAGTAGAADSCPTAAPPSGGTPDWTLTGTTGSVAVTGSTDTAAPVVNVTAPFSVTQTQVHTLRAGDGPAVPGTARVSVCYMGVNGRDGTVFDSSYQRGAPVDFPLGGVVPGFQKAIAGQKVGSTVAVAMTSADGYPDGQPSAGIRPGDTLVFAIKILGATT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 1 month | 1,853,210 | 8.2 | 0.008 | ○○○○○ 2.36 | 2.3634591602527064 | 24885784 |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 1 month | 1,853,165 | 8.34 | 0.0072 | ○○○○○ 2.41 | 2.408912726743758 | 24885784 |
Retrieved 2 of 2 entries in 15 ms
(Link to these results)