Bacterial taxon 262316
Locus MAP_2663c
Protein AAS04980.1
hypothetical protein
Mycobacterium avium subsp. paratuberculosis K10
Length 169 aa, Gene n/a, UniProt Q73WJ7
>AAS04980.1|Mycobacterium avium subsp. paratuberculosis K10|hypothetical protein
MTPYDVGLLILRLVLGVTLAAHGYNKFFGGGRIPGTARWFESIGMKPGKFHATVAASTEMAAGLGLAAGLLTPIPAAGFVSLMLVAAWTVHRPNGFFIVKEGWEYNLVLAASAVVVATLGAGRLSLDWLVFGKNWMDGWNGLLISLLLGLAGAIGQLVIFYRPPAKQTG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 1 month | 3,000,916 | -3.78 | 0.039 | ●●○○○ -1.56 | -1.5631808482914213 | 24885784 |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 1 month | 3,000,963 | -3.78 | 0.039 | ●●○○○ -1.56 | -1.5631808482914213 | 24885784 |
Retrieved 2 of 2 entries in 2.1 ms
(Link to these results)