Bacterial taxon 262316
Locus MAP_3088c
Protein AAS05636.1
hypothetical protein
Mycobacterium avium subsp. paratuberculosis K10
Length 276 aa, Gene n/a, UniProt Q73VC6
Protein visualisation (by ProViz)
>AAS05636.1|Mycobacterium avium subsp. paratuberculosis K10|hypothetical protein
MTSPEEAPLVPRPAATVMLVRDAPAGLKVFLMRRHSRMEFAAGVMVFPGGGVDERDRNADLGGLGAWAGPPPQWWAQRFGIEPDLAEALVCAAARETFEESGVLFAGPAGAPDSIVGDASVYRDARRALADGTLSFADFLRTEKLELRSDLLRPWANWVTPEAERTRRYDTYFFVGALPQGQRADGQNTESDRAGWTTPEAALEDFSAGRTFLLPPTWTQLDSLAGRTVADVLAVQRQIAPVQPHVEIRGDNWVFEFFDSDRYHRAREAGGLGWRH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 1 month | 3,435,872 | -4.64 | 0.024 | ●●○○○ -1.84 | -1.8428711656506893 | 24885784 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)