Bacterial taxon 431947
Locus PGN_1752
Protein WP_004583469.1
4Fe-4S dicluster domain-containing protein
Porphyromonas gingivalis ATCC 33277
Length 75 aa, Gene n/a, UniProt B2RLM6
>WP_004583469.1|Porphyromonas gingivalis ATCC 33277|4Fe-4S dicluster domain-containing protein
MAKIRGAVVVNTQRCKGCNLCVVACPTKVLELHPNEVNDKGYHYSYMKDPESCIGCTSCATVCPDACITVYKVKL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -0.51 | <1e-323 | ○○○○○ 3.96 | 3.957386843796597 | 28900609 |
Retrieved 1 of 1 entries in 24.6 ms
(Link to these results)