Bacterial taxon 431947
Locus PGN_1475
Protein WP_012458300.1
5'-methylthioadenosine/adenosylhomocysteine nucleosidase
Porphyromonas gingivalis ATCC 33277
Length 228 aa, Gene n/a, UniProt B2RKU9
>WP_012458300.1|Porphyromonas gingivalis ATCC 33277|5'-methylthioadenosine/adenosylhomocysteine nucleosidase
MNKTIGVVVAMGKEFRLLPDILENKEEIRDAVFRAVVGIVGGHRVIYALSGIGKVAAAVCAGELIRRYRPDYLINIGVSGGLGRNVAIHDTVVSTAVCYHDVSCGADIAWGQVQGFPLYYPVSEDLLALFRSLPVPVREGVVCCGDRFLSSSEEQDFVRRTFPDAVAVDMESAALAQVAYIYRVPFIAVRIISDIAGEGRDNFAEYMDFWRKASPATFSILERVFDAM
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -7.88 | 9.4e-15 | ●○○○○ -0.99 | -0.9906425259760949 | 28900609 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)