Bacterial taxon 431947
Locus PGN_0673
Protein WP_010956094.1
biopolymer transporter ExbD
Porphyromonas gingivalis ATCC 33277
Length 139 aa, Gene n/a, UniProt B2RIJ7
>WP_010956094.1|Porphyromonas gingivalis ATCC 33277|biopolymer transporter ExbD
MSLKRKTKVTEVFSMASMTDVIFLLLIFFMVTSTLIVPNALRVSLPSANKQPAPEAPLARITISEDMRYFAAFGQDKGHEVAFEEILPLLLQEQSRNPEMYVAIYADENVPYREIVKVLSMAGENKMKVVLATKAQSKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -8 | <1e-323 | ●●○○○ -1.07 | -1.0693660411337154 | 28900609 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)