Bacterial taxon 431947
Locus PGN_0492
Protein WP_005874447.1
cation transporter
Porphyromonas gingivalis ATCC 33277
Length 87 aa, Gene n/a, UniProt B2RI17
>WP_005874447.1|Porphyromonas gingivalis ATCC 33277|cation transporter
MYKPKSKTKDHKKKLLVKMKTTTFSVEGMMCGGCAASVEKAALGVQGVQTAFASLDSHSLTVDYAPETTSPEAIMKAVRLAGFECKL
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -5.06 | <1e-323 | ○○○○○ 0.91 | 0.9066118248667415 | 28900609 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)