Bacterial taxon 431947
Locus PGN_0593
Protein WP_012457628.1
conjugal transfer protein TraO
Porphyromonas gingivalis ATCC 33277
Length 194 aa, Gene traO, UniProt B2RIB7
>WP_012457628.1|Porphyromonas gingivalis ATCC 33277|conjugal transfer protein TraO
MKQLVFMFSVLWTLFSTNQAYAQRCLPGMQGIRITGGMVDGMHRLDSRNKLGYSFGLSMATYSKGGHQWVFGAEHLNKYYPYRANRIPVSQFTGEGGYFLNFLSTPGKTLLFSLGASALAGYETSNWGEKTLFDGATLRNKDGFVYGGALTLEMETYLSDRIVLLLTARERVLWGTSTGRFHAQFGAGLKWMIH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -8.69 | 8.9e-16 | ●●○○○ -1.53 | -1.5335022153644238 | 28900609 |
Retrieved 1 of 1 entries in 2.6 ms
(Link to these results)