Bacterial taxon 431947
Locus PGN_0026
Protein WP_004583429.1
cytidine deaminase
Porphyromonas gingivalis ATCC 33277
Length 158 aa, Gene n/a, UniProt B2RGQ0
>WP_004583429.1|Porphyromonas gingivalis ATCC 33277|cytidine deaminase
MLRKTLSTPYDIIPRSDFSADVLRLEGAAIEAARSAYAPYSRFSVGAAVLLDNGEILSGSNQENAAYPSGLCAERTVLFYAGARYPEAAVREMVLVAFSASGRVPLITPCGACRQVMLEVCSRHRPFPILMVGEEEAVRVSDVRLLLPFSFDGSDLER
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -2.87 | 2.7e-9 | ○○○○○ 2.38 | 2.3750482926610177 | 28900609 |
Retrieved 1 of 1 entries in 93 ms
(Link to these results)