Bacterial taxon 431947
Locus PGN_1629
Protein WP_021676670.1
DMT family transporter
Porphyromonas gingivalis ATCC 33277
Length 302 aa, Gene n/a, UniProt B2RLA3
>WP_021676670.1|Porphyromonas gingivalis ATCC 33277|DMT family transporter
MTSSRLYGLAVGILSSATFGLIPLFTLPVSAKGASFELILFYRFFFAAIAIGILHRLSGGSFKVSRADIGPLVLLGFLYAGTALFLFHGYGYMASGVATTIHFLYPLFVTALMLLFFGERLSPVPLTAIFIALIGVGLLMGLTGGGDRVGLTGFVIVAISALCYALYIVFVNRSRVRIMPGRRLTFYVFVAAAGFCLINVLVRQGEVAPLPDAASWGNILLLALVPTVISNLALVVAVRNIGSTLTSALGAMEPLTSVLVGVWVFDEVLGASAIVGMGCILIAVGLIVFSEPLELMLRRRRR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -3.53 | <1e-323 | ○○○○○ 1.93 | 1.927778866522916 | 28900609 |
Retrieved 1 of 1 entries in 55.3 ms
(Link to these results)