Bacterial taxon 431947
Locus PGN_0211
Protein WP_080504389.1
DNA methylase
Porphyromonas gingivalis ATCC 33277
Length 48 aa, Gene n/a, UniProt B2RH85
>WP_080504389.1|Porphyromonas gingivalis ATCC 33277|DNA methylase
MYNYFHSLLPPLSLAPFMPRTPLPSISLFFKGLLYYGREVIRQKSLVP
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -4.84 | 2.3e-8 | ○○○○○ 1.05 | 1.0518197455533906 | 28900609 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)