Bacterial taxon 431947
Locus PGN_0323
Protein WP_080504392.1
DNA methylase
Porphyromonas gingivalis ATCC 33277
Length 47 aa, Gene n/a, UniProt B2RHJ7
>WP_080504392.1|Porphyromonas gingivalis ATCC 33277|DNA methylase
MQVAPQGGIYNYFHSLLPPLSLAPFMPRTPLPSISLFCKGLDRVIRI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -2.54 | 7.3e-12 | ○○○○○ 2.6 | 2.5950279328825525 | 28900609 |
Retrieved 1 of 1 entries in 23.1 ms
(Link to these results)