Bacterial taxon 431947
Locus PGN_1988
Protein WP_077110614.1
DUF1661 domain-containing protein
Porphyromonas gingivalis ATCC 33277
Length 50 aa, Gene n/a, UniProt B2RMB1
>WP_077110614.1|Porphyromonas gingivalis ATCC 33277|DUF1661 domain-containing protein
MKMWRAIFYVLVREVKNLRAKTKKFSRVFSRKHEPQSGRFRRDFSFSHLR
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -5.07 | 3.6e-5 | ○○○○○ 0.89 | 0.8947335284427885 | 28900609 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)