Bacterial taxon 431947
Locus PGN_0085
Protein WP_012457229.1
DUF1896 domain-containing protein
Porphyromonas gingivalis ATCC 33277
Length 143 aa, Gene n/a, UniProt B2RGV9
>WP_012457229.1|Porphyromonas gingivalis ATCC 33277|DUF1896 domain-containing protein
MTAIHFSYYELSLLAFLRESHPEKADDIPFVKERAAGASEAYAEAFNAGLPIAECIGIANNTLYAGLHFSRHDTISSVLWNEFSAEVPLEAVRETAIRLRPLLESIFAKYPISDEFAYMPEYNSLYTEITGFVQLKLEEDGIL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -7.78 | <1e-323 | ●○○○○ -0.92 | -0.9186256332629287 | 28900609 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)