Bacterial taxon 431947
Locus PGN_0757
Protein WP_012457756.1
HAD family phosphatase
Porphyromonas gingivalis ATCC 33277
Length 208 aa, Gene n/a, UniProt B2RIT1
>WP_012457756.1|Porphyromonas gingivalis ATCC 33277|HAD family phosphatase
MIRNIVFDLGGVLIHLNREESIRRFKAIGVADIEEMLDPYLQKGLFLDLESGRKSEAEFRTELSRHIGEELTYQQVYDALFGFLEEISAEKFDYIDSLRPDYRLFLLSNTNPYVLDLAMSPRFLPSGRTLDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIPAITRLLREQK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -8.46 | 0.00033 | ●●○○○ -1.38 | -1.3775707987286248 | 28900609 |
Retrieved 1 of 1 entries in 990.9 ms
(Link to these results)