Bacterial taxon 431947
Locus PGN_0421
Protein WP_005873483.1
helix-hairpin-helix domain-containing protein
Porphyromonas gingivalis ATCC 33277
Length 234 aa, Gene n/a, UniProt B2RHU5
>WP_005873483.1|Porphyromonas gingivalis ATCC 33277|helix-hairpin-helix domain-containing protein
MKDSFHFGKSESIISILLLLMVIVGLFIFKARPASGNAPVAEAVQTSADEPGRKEEKKNYVRPYSSSEQSRKKSRDSIVTDADYVGPPVREAYARSADKFPRGTVIDLNAADSATLTRIPGIGPTFARRIVSYRRQLGGYYTVLQLQEVYGMDYERFCALRPWFKIGIKPDRIDLKGVVGDSILRHPYINYKQRAEIKRLLRSSQWQGSWVQLLKLPTFTKEDSIRLSPYFDIH
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -3.84 | 7.2e-8 | ○○○○○ 1.73 | 1.7261400183173847 | 28900609 |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)