Bacterial taxon 431947
Locus PGN_0154
Protein WP_012457284.1
hypothetical protein
Porphyromonas gingivalis ATCC 33277
Length 186 aa, Gene n/a, UniProt B2RH28
>WP_012457284.1|Porphyromonas gingivalis ATCC 33277|hypothetical protein
MEFWFIFAGTFTKKRTNMRMMKLTAMMLALLSALAFSSCKKDEPTTLEKTQWERMLTGAEINKIIALMDGEIDADSQLPESAKLKLELDFFSQTDANLNVDIMITPGITIKMKMKMPYMYNASTKSVLLRLSKSQVLSVEPMFPAFEDIDLSEAEDVTGVVDWKNKTMKLTMQGENHPVHIELTQK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -1 | <1e-323 | ○○○○○ 3.63 | 3.6250651039125565 | 28900609 |
Retrieved 1 of 1 entries in 21 ms
(Link to these results)