Bacterial taxon 431947
Locus PGN_0320
Protein WP_039417067.1
hypothetical protein
Porphyromonas gingivalis ATCC 33277
Length 162 aa, Gene n/a, UniProt B2RHJ4
>WP_039417067.1|Porphyromonas gingivalis ATCC 33277|hypothetical protein
MMKRIGFNKKAVPTEAEIGQLLDKYFDGLTSGAEEDRLRRYFATAKQPEQWEHLRPLFGYVSCRRAVDGRFLSDTRKLATRNLLSRRILWSVGGASVAAAIALTIALRSPHVADQPLPTTGSFAVVNGERVNDPDLVRLYAQEAFDAVSIDREELAQELFDL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -1.74 | 0.011 | ○○○○○ 3.13 | 3.1299118947378424 | 28900609 |
Retrieved 1 of 1 entries in 13.3 ms
(Link to these results)