Bacterial taxon 431947
Locus PGN_0406
Protein WP_080504396.1
hypothetical protein
Porphyromonas gingivalis ATCC 33277
Length 76 aa, Gene n/a, UniProt B2RHT0
>WP_080504396.1|Porphyromonas gingivalis ATCC 33277|hypothetical protein
MVREKNKTRAKSKKISHVKIFLVVRVFEILGSAILRLSAPKTTYDFSQYTSQSRESREGSVARIGICRRRRRIDSP
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -1.58 | 0.003 | ○○○○○ 3.24 | 3.2358741002453075 | 28900609 |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)