Bacterial taxon 431947
Locus PGN_0751
Protein WP_021663945.1
hypothetical protein
Porphyromonas gingivalis ATCC 33277
Length 129 aa, Gene n/a, UniProt B2RIS5
>WP_021663945.1|Porphyromonas gingivalis ATCC 33277|hypothetical protein
MRRTSSVYRVAQQCRQLIFLRLDGGNGSSIDYDLVKLKSGQPIGNAEKISSTKVRLSRKRKRCFAFGDHCFCSEAIGKCAHPAKKKRATQEYLDRPLFFMLTSFRGLSAPPEKSVVRSYNFIFCHPGSH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -4.03 | 0.0078 | ○○○○○ 1.6 | 1.5955263727617754 | 28900609 |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)