Bacterial taxon 431947
Locus PGN_0845
Protein WP_012457822.1
hypothetical protein
Porphyromonas gingivalis ATCC 33277
Length 119 aa, Gene n/a, UniProt B2RJ19
>WP_012457822.1|Porphyromonas gingivalis ATCC 33277|hypothetical protein
MEQERLNHSMDRRKRNNSSSHYRIKTGSGVSILIVASEYGNRACELTELLLCHVGFKTVPVVSVSKGNGYVRLYSWENYVAETCYDKDAESISLSQDEYDDDALLNAAIEKYFLTLTKQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -4.27 | 0.00017 | ○○○○○ 1.43 | 1.4333805760522214 | 28900609 |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)