Bacterial taxon 431947
Locus PGN_1610
Protein WP_010955985.1
hypothetical protein
Porphyromonas gingivalis ATCC 33277
Length 86 aa, Gene n/a, UniProt B2RL84
>WP_010955985.1|Porphyromonas gingivalis ATCC 33277|hypothetical protein
MVCEKWLVFVLISCFQNLIANSAGGFVAAIIRGWKKKACLPFSFRRRATKESGWICFGLCAFLWIAPLFELRQYRGIILALGKANI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -8.67 | 0.019 | ●●○○○ -1.52 | -1.5160637878419552 | 28900609 |
Retrieved 1 of 1 entries in 2.6 ms
(Link to these results)