Bacterial taxon 431947
Locus PGN_1816
Protein WP_012458554.1
hypothetical protein
Porphyromonas gingivalis ATCC 33277
Length 220 aa, Gene n/a, UniProt B2RLU0
>WP_012458554.1|Porphyromonas gingivalis ATCC 33277|hypothetical protein
MLRIGKTIFGLLALTILLGSCWSKKNDLGHDIPSQLVCRFTEGVLTEPGNGSINVDPSAFVAHSSDPFIQHLNTDFYGNFFPLPDNAPLKFKKGVWYKMEIFLFDGKNNPLNQQFLKPDQIEKHQFFFNLLSDESVIDKGISYYYSDFIDGHLLDSPVGFTGYIRVNQEVQDAQLRLLLVHLLKGDKYEADGKPNPFDKPSPRVLEFGDLTAFMPFKIEK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -5.27 | <1e-323 | ○○○○○ 0.76 | 0.7625465650118308 | 28900609 |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)