Bacterial taxon 431947
Locus PGN_1934
Protein WP_012458620.1
hypothetical protein
Porphyromonas gingivalis ATCC 33277
Length 78 aa, Gene n/a, UniProt B2RM58
>WP_012458620.1|Porphyromonas gingivalis ATCC 33277|hypothetical protein
MEIETLILLSLAVAGFTTIIVVAIVWYSKFKIRKEELEHQRLVEQEREKAKELNNSFAKSLLATNKEIIEVYCKNNTK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -3.62 | 0.0027 | ○○○○○ 1.87 | 1.869907010712667 | 28900609 |
Retrieved 1 of 1 entries in 22.3 ms
(Link to these results)