Bacterial taxon 431947
Locus PGN_0714
Protein WP_012457721.1
isochorismatase family protein
Porphyromonas gingivalis ATCC 33277
Length 170 aa, Gene n/a, UniProt B2RIN8
>WP_012457721.1|Porphyromonas gingivalis ATCC 33277|isochorismatase family protein
MVLLIVDPQVDFVSGSLAVEGAPKAMKALAEYMAAHRKEIKSIVVTMDQHPADHCSFVAQGGQWPSHCVRYTVGAAIEPCIAEALAACSAEGIPVEMIEKATTQERDAYSAFETEVPDSLRSAERIVMAGIAGDYCVRQSVLDLERHGLGERIELLKEGIAYIAEEENRP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -8.13 | <1e-323 | ●●○○○ -1.15 | -1.1539651401675122 | 28900609 |
Retrieved 1 of 1 entries in 2.3 ms
(Link to these results)