Bacterial taxon 431947
Locus PGN_0015
Protein WP_005874470.1
MarR family transcriptional regulator
Porphyromonas gingivalis ATCC 33277
Length 234 aa, Gene n/a, UniProt B2RGN9
>WP_005874470.1|Porphyromonas gingivalis ATCC 33277|MarR family transcriptional regulator
MKYKKLLFDLIDYLDAFESLHDGGSHEPEIKDFADFLSWRCGKKKKQEEEVVSVTRERAAGAKNIARGVSLLHRYSRFYIKKALTESPLQTEDEYTYLVSLMNGESMTKTELNNLNAMEKTSGAEVMRRLLKANLIEQRPDEEDRRSMRVSITPEGRKVLVNLFPNLRLCAETLVSALSDEQLTAFDHLLWLLCECHNEMFTGKHDAELTDLHAETCGLKQSAGGALSKRLYRR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -3.77 | 0.00064 | ○○○○○ 1.77 | 1.7677100287008551 | 28900609 |
Retrieved 1 of 1 entries in 95.1 ms
(Link to these results)