Bacterial taxon 431947
Locus PGN_1928
Protein WP_012458614.1
type III-B CRISPR module RAMP protein Cmr6
Porphyromonas gingivalis ATCC 33277
Length 248 aa, Gene n/a, UniProt B2RM52
>WP_012458614.1|Porphyromonas gingivalis ATCC 33277|type III-B CRISPR module RAMP protein Cmr6
MNFGHWYYREYFDTINLDSKGIVTNFSTFNKGKNDKLIKGATLPPYDKENDIEDVTSFELKTCYPGLLCGVGYHHEINNPKNEPKEDDAPEVYNLGMYFDYTSGLPVIPGSSIKGMLRSAIEEWDFLADYELNNGVTREEIIEKVFVGKEYSIYDRDIFLDAIPIKADNKLFGEDYITHHPTPLQNPNPVRFLRVNPGVTYQFRFILRNNDNGLKADFKEDLFKAIICTFGLGAKTNVGYGQFVEPEK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -3 | 3.1e-14 | ○○○○○ 2.29 | 2.288354944231574 | 28900609 |
Retrieved 1 of 1 entries in 48.4 ms
(Link to these results)