Bacterial taxon 431947
Locus PGN_0959
Protein WP_021663951.1
XRE family transcriptional regulator
Porphyromonas gingivalis ATCC 33277
Length 104 aa, Gene n/a, UniProt B2RJD3
>WP_021663951.1|Porphyromonas gingivalis ATCC 33277|XRE family transcriptional regulator
MDNILTLIDCNPQSVAMQVASRVKARRLEMNLTQEGIALRAGMKLPTYRRFERTGEISFRGLLQIGFALNALQDFALLFAQRQYQTLDEVLAEQQPKRKRGSKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -7.92 | <1e-323 | ●●○○○ -1.01 | -1.0118556029092103 | 28900609 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)