Bacterial taxon 431947
Locus PGN_0175
Protein WP_012457302.1
YggS family pyridoxal phosphate-dependent enzyme
Porphyromonas gingivalis ATCC 33277
Length 224 aa, Gene n/a, UniProt B2RH49
>WP_012457302.1|Porphyromonas gingivalis ATCC 33277|YggS family pyridoxal phosphate-dependent enzyme
MTHIAERLVPILRSLPQGVRLAAVSKFHPVEELMEAYEAGQRVFAESRVQELMSKVEAMPDDVEWHFIGPLQTNKVKYIVPFISMIQSVSSLKLFDEISRQASKVGRTVPVLLEVHIASEDTKSGFTPEELPQVLEAVLARGSDTGVKIAGLMGMATFTDDREQIRREFRRLASLFREMKERFFSDSADFCELSMGMSGDFELAIEEGSTIVRIGTTIFGERRY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -4.3 | 0.024 | ○○○○○ 1.41 | 1.4129996790006165 | 28900609 |
Retrieved 1 of 1 entries in 2.6 ms
(Link to these results)