Bacterial taxon 216597
Locus SL1344_1327
Protein CBW17423.1
Type III secretion system effector protein, Interferes with endosomal trafficking
Salmonella enterica Serovar Typhimurium SL1344
Length 133 aa, Gene ssaB, UniProt A0A0H3NAY4
>CBW17423.1|Salmonella enterica Serovar Typhimurium SL1344|Type III secretion system effector protein, Interferes with endosomal trafficking
MSEEGFMLAVLKGIPLIQDIRAEGNSRSWIMTIDGHPARGEIFSEAFSISLFLNDLESLPKPCLAYVTLLLAAHPDVHDYAIQLTADGGWLNGYYTTSSSSELIAIEIEKHLALTCILKNVIRNHHKLYSGGV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus gp91 phox) | liver | BTO:0000759 | 48 h | 1,437,057 | -2.57 | 0.00082 | ●●○○○ -1.89 | -1.8914500841573667 | 26787719 |
| Mouse (Mus musculus gp91 phox) | spleen | BTO:0001281 | 48 h | 1,437,057 | -2.1 | 0.039 | ●●○○○ -1.54 | -1.5410916861193618 | 26787719 |
Retrieved 2 of 2 entries in 2 ms
(Link to these results)