Bacterial taxon 909946
Locus STM474_4631
Protein WP_001019386.1
2-keto-myo-inositol isomerase IolI2
Salmonella enterica Serovar Typhimurium ST4 74
Length 271 aa, Gene n/a, UniProt E8XBI7
>WP_001019386.1|Salmonella enterica Serovar Typhimurium ST4 74|2-keto-myo-inositol isomerase IolI2
MNIEKTRFCINRKIAPGLSIEAFFRLVKRLEFNKVELRNDMPSGSVTDDLNYNQVRNLAEKYGLEIVTINAVYPFNQLTEEVVKKTEGLLRDAQGVGARALVLCPLNDGTIVPPEVTVEAIKRLSDLFARYDIQGLVEPLGFRVSSLRSAVWAQQLIREAGSPFKVLLDTFHHHLYEEAEKEFASRIDISAIGLVHLSGVEDTRPTEALADEQRIMLSEKDVMQNYQQVQRLENMGYRGIYAFEPFSSQLASWSEAEIEEQINRSVSLLLQ
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,700,599 | -7.92 | 1.4e-25 | ●●●●○ -3.94 | -3.93787180591458 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,700,599 | -3.7 | 2.9e-6 | ●●○○○ -1.74 | -1.74446302075968 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,700,599 | -3.64 | 0.00052 | ●●○○○ -1.72 | -1.71503596373062 | 23637626 |
Retrieved 3 of 3 entries in 0.6 ms
(Link to these results)