Bacterial taxon 909946
Locus STM474_3165
Protein WP_000383271.1
5-dehydro-4-deoxy-D-glucuronate isomerase
Salmonella enterica Serovar Typhimurium ST4 74
Length 278 aa, Gene kduI, UniProt E8X9J0
>WP_000383271.1|Salmonella enterica Serovar Typhimurium ST4 74|5-dehydro-4-deoxy-D-glucuronate isomerase
MDVRQSIHSEHAKTLDTQALRREFLIENIFVADEYTMVYSHIDRIIVGGIMPVSHPVEIGGEVGKQLGVSRLLDRRELGVINIGGAGAIIVDGQRHDIGHRDALYIGKGAKELVFVSNEASRPAKFYYNCAPAHTAYPTKKVSPADVAPVTLGDNLTSNRRTINKYFVPDVLETCQLSMGLTELAPGNLWNTMPCHTHERRMEVYLYFNMEEDSCVFHMMGQPQETRHIVMRNEQAVISPSWSIHSGVGTKAYTFVWGMVGENQVFDDMDHVAVQDLR
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,200,449 | -4.27 | 7.9e-12 | ●●●○○ -2.04 | -2.03872108543239 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,200,449 | -2.67 | 1.9e-6 | ●●○○○ -1.21 | -1.2099387463747 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,200,567 | -1.97 | 0.00018 | ●○○○○ -0.84 | -0.843754124545021 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,200,449 | -0.35 | 0.93 | ●○○○○ -0.01 | -0.00527412676877836 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,200,567 | -0.34 | 0.55 | ○○○○○ 0 | 0.00152554443761787 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,200,567 | -0.07 | 0.98 | ○○○○○ 0.14 | 0.141750048914374 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,200,223 | -0.07 | 0.97 | ○○○○○ 0.14 | 0.142847819997048 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,200,223 | -0.06 | 0.98 | ○○○○○ 0.15 | 0.147130243953856 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,200,223 | 0.38 | 0.52 | ○○○○○ 0.38 | 0.376929542358287 | 23637626 |
Retrieved 9 of 9 entries in 1.4 ms
(Link to these results)