Bacterial taxon 909946
Locus STM474_3746
Protein WP_000187489.1
7-cyano-7-deazaguanine/7-aminomethyl-7- deazaguanine transporter
Salmonella enterica Serovar Typhimurium ST4 74
Length 221 aa, Gene yhhQ, UniProt E8XF91
>WP_000187489.1|Salmonella enterica Serovar Typhimurium ST4 74|7-cyano-7-deazaguanine/7-aminomethyl-7- deazaguanine transporter
MTPFTQSQRIKALFWLSLFHLLVIISSNYLVQLPITIFGFHTTWGAFSFPFIFLATDLTVRIFGAPLARRIIFAVMIPALLVSYVVSSLFYMGAWQGFAALANFNLFVARIAAASFMAYALGQILDVHVFNRLRQNRRWWLAPTASTLFGNISDTLAFFFIAFWRSPDAFMAGHWMEIALVDYCFKVLISIIFFLPMYGVLLNMLLKKLADKSEISPLPAS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,768,517 | -5.39 | 8.5e-17 | ●●●○○ -2.62 | -2.62297522845191 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,768,299 | -1.94 | 0.036 | ●○○○○ -0.83 | -0.829957236369767 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,768,299 | -0.12 | 0.97 | ○○○○○ 0.11 | 0.113244397975801 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,768,757 | 0.05 | 1 | ○○○○○ 0.2 | 0.203315665606452 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,768,517 | 0.05 | 1 | ○○○○○ 0.2 | 0.204454118765851 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,768,299 | 0.45 | 0.57 | ○○○○○ 0.41 | 0.413109978360067 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,768,517 | 0.92 | 0.58 | ○○○○○ 0.66 | 0.6572039286205 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,768,757 | 1 | 0.18 | ○○○○○ 0.69 | 0.694514944970487 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,768,757 | 1.21 | 0.43 | ○○○○○ 0.81 | 0.807325631746808 | 23637626 |
Retrieved 9 of 9 entries in 33.3 ms
(Link to these results)