Bacterial taxon 909946
Locus STM474_1348
Protein WP_000562009.1
anti-FlhDC factor YdiV
Salmonella enterica Serovar Typhimurium ST4 74
Length 237 aa, Gene cdgr, UniProt E8XGF0
>WP_000562009.1|Salmonella enterica Serovar Typhimurium ST4 74|anti-FlhDC factor YdiV
MIASLDELYHSELFFLPVMDENARLVGLEIIATFAAEDGAVRMPTELVAPRLSVEEQYCLFVEKLALLETCQHFFIQHKLIAWLNLPPAISDLLLLDSELFSRAARFPFLKLAINENYPGLNQGKNNETLANLAMHFPLMLANFGAGEASTKAIFDGLFKRVMLDKNFIQQRAEMISFEPFMHAIVAQISSSCESLMIAGIDTEAMFARAAPLGFSAFQGGLWPPVPVSQLIKLVQR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,379,792 | -4.68 | 2.5e-17 | ●●●○○ -2.26 | -2.25530328717998 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,379,792 | -4.07 | 0.003 | ●●○○○ -1.93 | -1.93484067691492 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,380,195 | -3.19 | 2.3e-6 | ●●○○○ -1.48 | -1.4783859496371 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,380,195 | -2.19 | 1.2e-5 | ●○○○○ -0.96 | -0.960064425978046 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,380,195 | -1.9 | 0.14 | ●○○○○ -0.81 | -0.810606157795916 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,380,185 | -1.82 | 0.11 | ●○○○○ -0.77 | -0.767400838333441 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,379,792 | -1.77 | 0.17 | ●○○○○ -0.74 | -0.744564238785138 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,380,185 | -1.26 | 0.44 | ●○○○○ -0.47 | -0.474673844329712 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,380,185 | 0.15 | 0.82 | ○○○○○ 0.26 | 0.25622802053411 | 23637626 |
Retrieved 9 of 9 entries in 74.5 ms
(Link to these results)