Bacterial taxon 909946
Locus STM474_3732
Protein WP_000778873.1
aspartate 1-decarboxylase autocleavage activator PanM
Salmonella enterica Serovar Typhimurium ST4 74
Length 127 aa, Gene panZ, UniProt E8XF77
>WP_000778873.1|Salmonella enterica Serovar Typhimurium ST4 74|aspartate 1-decarboxylase autocleavage activator PanM
MKLTILRLEHFSAQDQIDLGKIWPEYSASSLSVDETHRIYAARFNERLLGAVRVTLSGTQGALDSLRVREITRRRGVGQYLVEEVIRDNPNVSSWWMADVGVEDRSVMAAFMQALGFTAQHDGWEKR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,755,444 | 1.72 | 0.021 | ○○○○○ 1.07 | 1.0713705225749 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,755,444 | 0.87 | 0.78 | ○○○○○ 0.63 | 0.629010576937915 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,755,444 | 1.13 | 0.45 | ○○○○○ 0.76 | 0.764048352920507 | 23637626 |
Retrieved 3 of 3 entries in 2.5 ms
(Link to these results)