Bacterial taxon 909946
Locus STM474_4258
Protein WP_000981826.1
autoinducer 2 ABC transporter permease LsrD
Salmonella enterica Serovar Typhimurium ST4 74
Length 333 aa, Gene ydeZ, UniProt E8XKE3
>WP_000981826.1|Salmonella enterica Serovar Typhimurium ST4 74|autoinducer 2 ABC transporter permease LsrD
MMNPWRRYSWEIALAALLIFEILAFGLINPRLLDINVLLFSTSDFICIGIVALPLTMVIVSGGMDISFGSTIGLCAITLGVLFQLGMPLPLAIIITLLLGAICGLINAGLIIYTGVNPLVITLGTMYLFGGSALLLSGMAGATGYEGIGGFPTAFTDFANISFLGIPMPLIFFLVCCLFFWLLMHRTHMGRNVFLIGQSARVAQYSAIPVNRTLYTVYAMTGCASAIAAVLLVSYFGSARSDLGASFLMPAITAVVLGGANIYGGSGSIMGSALAALLVGFLQQGLQMAGVPNQISSALSGALLIVVVVGRSVSLHRHQILEWYSRRRNAHQA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,307,950 | -5.27 | 8.6e-8 | ●●●○○ -2.56 | -2.55956063946763 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,307,950 | -4.42 | 2.6e-5 | ●●●○○ -2.12 | -2.11674441300993 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,307,950 | -3.75 | 8.1e-8 | ●●○○○ -1.77 | -1.77022994606722 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,308,448 | -3.04 | 6.1e-7 | ●●○○○ -1.4 | -1.40174847052094 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,308,124 | -2.77 | 0.0032 | ●●○○○ -1.26 | -1.26162471050376 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,308,448 | -2.23 | 0.013 | ●○○○○ -0.98 | -0.98265378549947 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,307,530 | -2.04 | 2.9e-6 | ●○○○○ -0.88 | -0.884673487591032 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,308,124 | -1.35 | 0.03 | ●○○○○ -0.52 | -0.522691110640906 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,307,530 | -0.31 | 0.81 | ○○○○○ 0.01 | 0.0141384864451609 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,308,124 | -0.25 | 0.94 | ○○○○○ 0.05 | 0.046911210397348 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,308,448 | 0.05 | 1 | ○○○○○ 0.2 | 0.202652286748265 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,307,530 | 0.13 | 1 | ○○○○○ 0.25 | 0.245405908342443 | 23637626 |
Retrieved 12 of 12 entries in 2.7 ms
(Link to these results)