Bacterial taxon 909946
Locus STM474_2163
Protein WP_000954848.1
bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE
Salmonella enterica Serovar Typhimurium ST4 74
Length 203 aa, Gene hisI, UniProt E8XC32
>WP_000954848.1|Salmonella enterica Serovar Typhimurium ST4 74|bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE
MLTEQQRRELDWEKTDGLMPAIVQHAVSGEVLMLGYMNPQALDKTIESGHVTFFSRTKQRLWTKGETSGHVLNVVSIAPDCDNDTLLVLANPVGPTCHKGTSSCFGDASHQWLFLYQLEQLLAERKTADPTSSYTAKLYASGTKRIAQKVGEEGVETALAATVNDRFELTNEASDLMYHLLVLLQDQDLNLTTVIDNLRKRHQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,154,115 | -2.18 | 0.00042 | ●○○○○ -0.96 | -0.957435112169304 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,154,115 | -0.05 | 0.97 | ○○○○○ 0.15 | 0.152754770338456 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,154,115 | 1.57 | 0.12 | ○○○○○ 0.99 | 0.990939272844499 | 23637626 |
Retrieved 3 of 3 entries in 1.7 ms
(Link to these results)