Bacterial taxon 909946
Locus STM474_1157
Protein WP_000414441.1
biofilm formation regulator BssS
Salmonella enterica Serovar Typhimurium ST4 74
Length 84 aa, Gene bssS, UniProt E8XET0
Protein visualisation (by ProViz)
>WP_000414441.1|Salmonella enterica Serovar Typhimurium ST4 74|biofilm formation regulator BssS
MEKNNEVIQTHPLVGWDISTVDSYDALMLRLHYQTPNRPEPEGTEVGQTLWLTTDVARQFISILEAGIAKIESGDYQENEYRRH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,203,941 | 1.57 | 0.0017 | ○○○○○ 0.99 | 0.994047523617356 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,203,941 | -0.04 | 0.99 | ○○○○○ 0.15 | 0.154295524149755 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,203,941 | 0.73 | 0.86 | ○○○○○ 0.56 | 0.555306214897624 | 23637626 |
Retrieved 3 of 3 entries in 1.5 ms
(Link to these results)