Bacterial taxon 909946
Locus STM474_3310
Protein WP_000527859.1
biopolymer transporter ExbB
Salmonella enterica Serovar Typhimurium ST4 74
Length 244 aa, Gene exbB, UniProt E8XAL0
>WP_000527859.1|Salmonella enterica Serovar Typhimurium ST4 74|biopolymer transporter ExbB
MGNNLMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFTQKRRLKREQLQLADARSLDQASDIAAGFSAKSLSAQLINEAQNELELSQGSEDNEGIKERTGFRLERRVAAVGRYMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAIGLVAAIPAVVIYNIFARQIGSYKATLGDVAAQVLLLQSRDLDLNASASAQPVRAAQKLRVG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,341,193 | -4.75 | 1.8e-5 | ●●●○○ -2.29 | -2.28763109707209 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,341,193 | -3.41 | 0.0092 | ●●○○○ -1.59 | -1.59290148225208 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,341,104 | -1.82 | 0.16 | ●○○○○ -0.77 | -0.76765429923138 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,341,326 | -1.8 | 0.47 | ●○○○○ -0.76 | -0.757473001673212 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,341,104 | -0.93 | 0.1 | ●○○○○ -0.31 | -0.305580159261027 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,341,326 | -0.58 | 0.71 | ●○○○○ -0.13 | -0.126263521880975 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,341,193 | -0.06 | 0.93 | ○○○○○ 0.15 | 0.148096943116481 | 23637626 |
Retrieved 7 of 7 entries in 108.8 ms
(Link to these results)