Bacterial taxon 909946
Locus STM474_1051
Protein WP_001220671.1
cell division protein ZapC
Salmonella enterica Serovar Typhimurium ST4 74
Length 180 aa, Gene ycbW, UniProt E8XE16
>WP_001220671.1|Salmonella enterica Serovar Typhimurium ST4 74|cell division protein ZapC
MRIKPDDNWRWYYDEEHDRMMLDLANGMLFRSRFSRKMLTPDAFCPTGFCVDDAALYFSFEEKCRDFELTKEQRAELVLNALVAIRYLKPQMPKSWHFVAHGEMWTPGTGDAASVWLSDTAEQVNLLVVEPGENAALCLLAQPGVVIAGRTMQLGDAIKIMNDRLKPQVHCHSFSLEQAV
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,104,541 | -6.1 | 2.0e-23 | ●●●○○ -2.99 | -2.99080679979911 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,104,541 | -5.76 | 9.3e-7 | ●●●○○ -2.82 | -2.81605967809522 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,104,541 | -1.6 | 0.24 | ●○○○○ -0.65 | -0.653706573908965 | 23637626 |
Retrieved 3 of 3 entries in 1 ms
(Link to these results)