Bacterial taxon 909946
Locus STM474_3018
Protein WP_001147852.1
chaperone SicP
Salmonella enterica Serovar Typhimurium ST4 74
Length 130 aa, Gene sicP, UniProt E8XL07
>WP_001147852.1|Salmonella enterica Serovar Typhimurium ST4 74|chaperone SicP
MQAHQDIIANIGEKLGLPLTFDDNNQCLLLLDSDIFTSIEAKDDIWLLNGMIIPLSPVCGDSIWRQIMVINGELAANNEGTLAYIDAAETLLLIHAITDLTNTYHIISQLESFVNQQEALKNILQEYAKV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,046,406 | -5.32 | 1.8e-6 | ●●●○○ -2.59 | -2.58683301557164 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,046,406 | -4.52 | 2.7e-5 | ●●●○○ -2.17 | -2.1688789222476 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,046,406 | -4.42 | 7.9e-16 | ●●●○○ -2.12 | -2.11853559076667 | 23637626 |
Retrieved 3 of 3 entries in 87.4 ms
(Link to these results)