Bacterial taxon 909946
Locus STM474_1953
Protein WP_000147295.1
chemotaxis protein CheW
Salmonella enterica Serovar Typhimurium ST4 74
Length 167 aa, Gene cheW, UniProt E8XA68
>WP_000147295.1|Salmonella enterica Serovar Typhimurium ST4 74|chemotaxis protein CheW
MTGMSNVSKLAGEPSGQEFLVFTLGNEEYGIDILKVQEIRGYDQVTRIANTPAFIKGVTNLRGVIVPIVDLRVKFCEGDVEYDDNTVVIVLNLGQRVVGIVVDGVSDVLSLTAEQIRPAPEFAVTLSTEYLTGLGALGERMLILVNIEKLLNSEEMALLDIAASHVA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,974,248 | 1.19 | 0.024 | ○○○○○ 0.79 | 0.794522819967715 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,974,248 | 0.1 | 0.95 | ○○○○○ 0.23 | 0.228404792763224 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,974,248 | 1.29 | 0.58 | ○○○○○ 0.85 | 0.84935552855411 | 23637626 |
Retrieved 3 of 3 entries in 1.2 ms
(Link to these results)