Bacterial taxon 909946
Locus STM474_0771
Protein WP_000124676.1
colicin uptake protein TolR
Salmonella enterica Serovar Typhimurium ST4 74
Length 142 aa, Gene tolR, UniProt E8XAY1
>WP_000124676.1|Salmonella enterica Serovar Typhimurium ST4 74|colicin uptake protein TolR
MARTRGRGRRELKSEINIVPLLDVLLVLLLIFMATAPIITQSVEVDLPEANQSQAVSSNDDPPVIIEVSGVGQYSVVVDKDRMDQLPSEQVIAEVKRHLQANPKTVFLIGGAKEVPYDEIIKALNLLHSAGVKSVGLMTQPI
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 813,962 | 2.43 | 0.0028 | ○○○○○ 1.44 | 1.43691074649949 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 813,962 | 0.7 | 0.85 | ○○○○○ 0.54 | 0.542114064042787 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 813,962 | 1.13 | 0.47 | ○○○○○ 0.76 | 0.7629826162858 | 23637626 |
Retrieved 3 of 3 entries in 24 ms
(Link to these results)