Bacterial taxon 909946
Locus STM474_2461
Protein WP_000262102.1
colicin V production protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 162 aa, Gene cvpA, UniProt E8XF17
>WP_000262102.1|Salmonella enterica Serovar Typhimurium ST4 74|colicin V production protein
MVWIDYAIIAVIAFSCLVSLIRGFVREALSLVTWGCAFFVASHYYTYLSVWFTGFEDELVRNGIAIAVLFIATLIVGAIVNFVIGQLVEKTGLSGTDRVLGICFGALRGALIVAAILFFLDTFTGLSKSEDWSKSQLIPQFSFIIRWFFDYLQSSSSFLPRT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,473,886 | -3.37 | 0.0018 | ●●○○○ -1.57 | -1.57135850190908 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,473,886 | -1.29 | 0.34 | ●○○○○ -0.49 | -0.490500717656124 | 23637626 |
Retrieved 2 of 2 entries in 2.4 ms
(Link to these results)