Bacterial taxon 909946
Locus STM474_1140
Protein WP_000557256.1
curli assembly protein CsgC
Salmonella enterica Serovar Typhimurium ST4 74
Length 108 aa, Gene csgC, UniProt E8XER3
Protein visualisation (by ProViz)
>WP_000557256.1|Salmonella enterica Serovar Typhimurium ST4 74|curli assembly protein CsgC
MHTLLLLAALSNQITFTTTQQGDIYTVIPQVTLNEPCVCQVQILSVRDGVGGQSHTQQKQTLSLPANQPIELSRLSVNISSEDSVKIIVTVSDGQSLHLSQQWPPSAQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,188,605 | -3.84 | 7.4e-5 | ●●○○○ -1.82 | -1.81706483142527 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,188,605 | -1.95 | 0.00011 | ●○○○○ -0.83 | -0.83482154156743 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,188,605 | -0.75 | 0.78 | ●○○○○ -0.21 | -0.211360026591822 | 23637626 |
Retrieved 3 of 3 entries in 38.5 ms
(Link to these results)