Bacterial taxon 909946
Locus STM474_0460
Protein WP_000019878.1
cytochrome o ubiquinol oxidase subunit IV
Salmonella enterica Serovar Typhimurium ST4 74
Length 109 aa, Gene cyoD, UniProt E8XKM7
>WP_000019878.1|Salmonella enterica Serovar Typhimurium ST4 74|cytochrome o ubiquinol oxidase subunit IV
MSHSTESGGASHGSVKTYMTGFILSVILTVIPFWMVMTGAASPAVILGSILAMAVVQILVHLVCFLHMNTKSDEGWNMTAFIFTVLIIAILVVGSIWIMWNLNYNMMMH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 494,007 | -2.27 | 5.5e-6 | ●●○○○ -1 | -1.00067788460956 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 493,968 | -1.02 | 0.14 | ●○○○○ -0.35 | -0.350702142131823 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 494,007 | -0.66 | 0.8 | ●○○○○ -0.16 | -0.163343905369591 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 494,007 | -0.22 | 0.88 | ○○○○○ 0.06 | 0.0628772943441381 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 493,968 | 0.18 | 0.99 | ○○○○○ 0.27 | 0.272179529393901 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 493,968 | 2.14 | 0.12 | ○○○○○ 1.29 | 1.28908939882896 | 23637626 |
Retrieved 6 of 6 entries in 0.8 ms
(Link to these results)