Bacterial taxon 909946
Locus STM474_1963
Protein WP_000754800.1
DJ-1 family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 185 aa, Gene n/a, UniProt E8XA77
>WP_000754800.1|Salmonella enterica Serovar Typhimurium ST4 74|DJ-1 family protein
MKKVAVLLAPGFEEAEAIVTLDILRRLHIDVETLACAESRAVVSYHDIPMVADSTLSERQQALFDAVVLPGGPQGSANLAANPAVIAFVARHDAAGKLICPICSAAARVLGAHGLLKGRRYVCSGDLWKAVPEGVYVDAPVVEDGNLISGKGLGHVFDFALTLSARLLGDDAPVREQAEHIYYPW
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,984,239 | -2.31 | 3.7e-11 | ●●○○○ -1.02 | -1.02344314952965 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,984,166 | -1.72 | 0.0017 | ●○○○○ -0.72 | -0.715512256295032 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,984,239 | -1.57 | 0.27 | ●○○○○ -0.64 | -0.638568434982063 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,984,239 | -0.51 | 0.7 | ●○○○○ -0.09 | -0.0886811236012942 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,984,166 | 0.22 | 1 | ○○○○○ 0.29 | 0.292666765756077 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,984,166 | 1.16 | 0.39 | ○○○○○ 0.78 | 0.782091053883954 | 23637626 |
Retrieved 6 of 6 entries in 0.9 ms
(Link to these results)