Bacterial taxon 909946
Locus STM474_0145
Protein WP_001286419.1
DNA gyrase inhibitor YacG
Salmonella enterica Serovar Typhimurium ST4 74
Length 63 aa, Gene yacG, UniProt E8XH49
>WP_001286419.1|Salmonella enterica Serovar Typhimurium ST4 74|DNA gyrase inhibitor YacG
MSDVTVVNCPTCGKPVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIASSGDQSDSDDWSEER
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 162,297 | -3.01 | 1.8e-8 | ●●○○○ -1.39 | -1.38733122299979 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 162,297 | 0.35 | 0.97 | ○○○○○ 0.36 | 0.358352256742329 | 23637626 |
Retrieved 2 of 2 entries in 24.2 ms
(Link to these results)