Bacterial taxon 909946
Locus STM474_2361
Protein WP_000884990.1
DNA oxidative demethylase AlkB
Salmonella enterica Serovar Typhimurium ST4 74
Length 216 aa, Gene alkB, UniProt E8XEA7
>WP_000884990.1|Salmonella enterica Serovar Typhimurium ST4 74|DNA oxidative demethylase AlkB
MLDLFADEAPWQEPLAPGAVVLRRFAFRAAQSLLDDIGFVASQSPFRQMVTPGGYTMSVAMTNCGALGWTTDRHGYCYAVRDPLTDKPWPALPLSFASVCRQAAIAAGYASFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGVPAVFQFGGLRRSDPIQRILLEHGDIVVWGGESRLFYHGIQPLKAGFHPMTGEFRYNLTFRQAAEKE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,360,282 | -5.67 | 7.9e-22 | ●●●○○ -2.76 | -2.7649722330121 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,360,282 | -1.41 | 0.34 | ●○○○○ -0.55 | -0.55330717871416 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,360,438 | -0.94 | 0.072 | ●○○○○ -0.31 | -0.311281574344799 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,360,282 | 0.04 | 1 | ○○○○○ 0.2 | 0.19623300630563 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,360,438 | 0.05 | 1 | ○○○○○ 0.21 | 0.205428207257661 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,360,438 | 1.64 | 0.32 | ○○○○○ 1.03 | 1.02943333538978 | 23637626 |
Retrieved 6 of 6 entries in 50.2 ms
(Link to these results)